PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR05G21420.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family ARF
Protein Properties Length: 720aa    MW: 78750.5 Da    PI: 7.1652
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR05G21420.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B377.91.1e-24150251199
                      EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSS CS
               B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrs 88 
                      f+k+lt sd++++g +++p++ ae++      + +++ s++l+ +d++g +W++++iyr++++r++lt+GW+ Fv+ ++L +gD v+F   + +
  LPERR05G21420.1 150 FCKTLTASDTSTHGGFSVPRRAAEDCfppldyS-QQRPSQELVAKDLHGTEWRFRHIYRGQPRRHLLTTGWSAFVNKKKLVSGDAVLFL--RGD 240
                      99****************************963.3445679************************************************..348 PP

                      EE..EEEEE-S CS
               B3  89 efelvvkvfrk 99 
                      ++el+++v+r+
  LPERR05G21420.1 241 DGELRLGVRRA 251
                      9999***9996 PP

2Auxin_resp112.54.1e-37276356182
       Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsL 82 
                      +aha+ t+svF+++YnPr s+seF+v+++k++k+l+++++vGmRfkm++e+ed+ err++G+++g  d+dp  W++SkW++L
  LPERR05G21420.1 276 VAHAVGTESVFNIYYNPRLSQSEFIVPYWKFMKSLSQPFAVGMRFKMRYESEDATERRYTGIITGSGDTDP-MWHGSKWKCL 356
                      699********************************************************************.9********9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.0E-40144253IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.14E-43145266IPR015300DNA-binding pseudobarrel domain
CDDcd100175.42E-23148250No hitNo description
SMARTSM010195.3E-23150252IPR003340B3 DNA binding domain
PROSITE profilePS5086313.493150252IPR003340B3 DNA binding domain
PfamPF023621.3E-22150251IPR003340B3 DNA binding domain
PfamPF065073.3E-31276356IPR010525Auxin response factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 720 aa     Download sequence    Send to blast
MAGIDLNTVE EDEEEAAAAA EKVAAAANFS PAPAARTSAV CLELWHACAG PVLPLPRKGS  60
VVVYLPQGHL DHLADASSSA AAAAAAVQPH VFCRVVDVTL LADAATDEVY AQLSLVPEKE  120
EVARRTEDGD GEEDGDAATK QRFARMPHMF CKTLTASDTS THGGFSVPRR AAEDCFPPLD  180
YSQQRPSQEL VAKDLHGTEW RFRHIYRGQP RRHLLTTGWS AFVNKKKLVS GDAVLFLRGD  240
DGELRLGVRR AAQLKNGSAF PALYNQCSNL GTLANVAHAV GTESVFNIYY NPRLSQSEFI  300
VPYWKFMKSL SQPFAVGMRF KMRYESEDAT ERRYTGIITG SGDTDPMWHG SKWKCLLVRW  360
DDDAEFRRPN RVSPWEIELT SSVSGSHLST PHSKRLKPCL PHVNPDYMAP HGGGCPDFAE  420
SAQFHKVLQG QELLGFKSHG GTAVATSQPC EARHLQYINE RSCSNDASNS ILGVPRLGDR  480
APLGNQGFPY HCSGFGESQR LQKVLQGQEV FRPYRGTLVD ASIGSNGFHQ QDGPRAPGVV  540
NKWHAQLHGR AAFHGPPAPA IPSQSSSPPS VLMFQQANSK MPRFEFGLGQ LDRRESDGRV  600
RLVPSEGIER REQRIPPQPY PTPGEVIDGQ PTVEKSHSPG RVGKDGPDNK AVGTNSCKIF  660
GISLTETVPA REELDHGDAN YSLQSLKQVP KSLGNSCATV HEQRPVVGRV IDISTMDMMI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-116233861361Auxin response factor 1
4ldw_A1e-116233861361Auxin response factor 1
4ldw_B1e-116233861361Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). {ECO:0000256|RuleBase:RU004561}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0712900.0AB071290.1 Oryza sativa OsETTIN1 mRNA for Arabidopsis ETTIN-like protein 1, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015640263.10.0PREDICTED: auxin response factor 15
SwissprotQ8S9850.0ARFO_ORYSJ; Auxin response factor 15
TrEMBLA0A0D9WJQ60.0A0A0D9WJQ6_9ORYZ; Auxin response factor
STRINGORGLA05G0222700.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25373580
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33860.11e-162ARF family protein